The protein structure alignment is calculated on the following chains: 2ny7:H; 3u7y:H.
2ny7:H: ANTIBODY B12, HEAVY CHAIN; ANTIGEN-BINDING FRAGMENT, FAB;
3u7y:H: NIH45-46 HEAVY CHAIN, IG GAMMA-1 CHAIN C REGION;
After structure superposition, other chains that are added to the superimposed structures are: 2ny7:G,L; 3u7y:G,L.
2ny7:G: ENVELOPE GLYCOPROTEIN GP120; CORE; 2ny7:L: ANTIBODY B12, LIGHT CHAIN; ANTIGEN-BINDING FRAGMENT, FAB;
3u7y:G: ENVELOPE GLYCOPROTEIN GP160; GP120 CORE (UNP RESIDUES 43-122, 201-303, 325-486); 3u7y:L: NIH45-46 LIGHT CHAIN, IG KAPPA CHAIN C REGION;

# Equivalent-residues=220; RMSD=2.11; P-value=0.00e+00; Identity=69.30%; Similarity=79.82%
/2ny7H.pdb/ /H/ 1 QVQLVQSGAEVKKPGASVKVSCQASGYRFSNFVIHWVRQAPGQRFEWMGWINPYNGNKEFSAKFQDRVTFTADTSANTAYMELRSLRSADTAVYYCARVGPYSWDDSPQDNYYMDVWGKGTTVIVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPK

1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11111111111111111111111111111111111 1111111111111111111111111111111111111111111111111111111111111111111111111111111111

/3u7yHGL-tran.pdb/ /H/ 1 EVRLSQSGGQMKKPGESMRLSCRASGYEFLNCPINWIRLAPGRRPEWMGWLKPRGGAVNYARKFQGRVTMTRDVYSDTAFLELRSLTSDDTAVYFCTRGKYCTAR--DYYNWDFEHWGRGAPVTVSSASTKGPSVFPLAPSS----GGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK


2ny7H_3u7yH.pdb
2ny7H.pdb
2ny7HGL-tran.pdb
3u7yHGL-tran.pdb
Jmol tips and trouble shooting