The protein structure alignment is calculated on the following chains: 2ny7:H; 3u7y:H.
2ny7:H: ANTIBODY B12, HEAVY CHAIN; ANTIGEN-BINDING FRAGMENT, FAB;
3u7y:H: NIH45-46 HEAVY CHAIN, IG GAMMA-1 CHAIN C REGION;
After structure superposition, other chains that are added to the superimposed structures are: 2ny7:G,L; 3u7y:G,L.
2ny7:G: ENVELOPE GLYCOPROTEIN GP120; CORE; 2ny7:L: ANTIBODY B12, LIGHT CHAIN; ANTIGEN-BINDING FRAGMENT, FAB;
3u7y:G: ENVELOPE GLYCOPROTEIN GP160; GP120 CORE (UNP RESIDUES 43-122, 201-303, 325-486); 3u7y:L: NIH45-46 LIGHT CHAIN, IG KAPPA CHAIN C REGION;

        /2ny7H.pdb/ /H/ 1    6    11   16   21   26   31   36   41   46   51   55   60   65   70   75   80   82   87   92   97   100  100  102  107  112  117  122  127  134  139  144  149  154  164  169  175  180  186  191  196  203  209  214  219  226  
QVQLVQSGAEVKKPGASVKVSCQASGYRFSNFVIHWVRQAPGQRFEWMGWINPYNGNKEFSAKFQDRVTFTADTSANTAYMELRSLRSADTAVYYCARVGPYSWDDSPQDNYYMDVWGKGTTVIVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSC
/2ny7HGL-tran.pdb/ /H/ 1 6 11 16 21 26 31 36 41 46 51 55 60 65 70 75 80 82 87 92 97 100 100 102 107 112 117 122 127 134 139 144 149 154 164 169 175 180 186 191 196 203 209 214 219 226 /G/ 83 88 93 98 103 108 113 118 206 211 216 221 226 231 236 241 246 251 256 261 266 271 276 281 286 291 296 330 335 340 345 350 355 360 365 370 375 380 385 390 395 400 413 418 423 428 433 438 443 448 453 458 463 468 473 478 483 488 734 795 897 /L/ 1 6 11 16 21 26 30 35 40 45 50 55 60 65 70 75 80 85 90 95 100 105 110 115 120 125 130 135 140 145 150 155 160 165 170 175 180 185 190 195 200 205 210
QVQLVQSGAEVKKPGASVKVSCQASGYRFSNFVIHWVRQAPGQRFEWMGWINPYNGNKEFSAKFQDRVTFTADTSANTAYMELRSLRSADTAVYYCARVGPYSWDDSPQDNYYMDVWGKGTTVIVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSC EVVLVNVTENFNWCKNDMVEQMHEDICSLWDQSLKPCVACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSSQLLLNGSLAEEEVVIRSCNFTDNAKTIIVQLNTSVEINCTGAGHCNIARAKWNNTLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHWFNCGGEFFYCNSTQLFNSTWFNSTWSGSDTITLPCRIKQIINMWCKVGKMMYAPPISGQIRCSSNITGLLLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIEXXXXXXXXXXXXX EIVLTQSPGTLSLSPGERATFSCRSSHSIRSRRVAWYQHKPGQAPRLVIHGVSNRASGISDRFSGSGSGTDFTLTITRVEPEDFALYYCQVYGASSYTFGQGTKLERKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLRSPVTKSFNRGEC
/3u7yHGL-tran.pdb/ /H/ 1 6 11 16 21 26 31 36 41 46 51 55 60 65 70 75 80 82 87 92 97 99 103 108 113 118 123 128 137 142 147 152 157 162 167 172 177 182 187 192 197 202 207 212 217 /G/ 44 49 54 59 64 69 74 79 84 89 94 99 104 109 114 119 124 202 207 212 217 222 227 232 237 242 247 252 257 262 267 272 277 282 287 292 297 325 330 335 340 345 350 355 361 366 371 376 381 386 391 396 413 418 423 428 433 438 443 448 453 458 463 468 473 478 483 488 1 502 /L/ 3 8 13 18 23 28 33 38 43 48 53 58 63 68 73 78 83 88 93 98 103 108 113 118 123 128 133 138 143 148 153 158 163 168 173 178 183 188 193 198 203 208
EVRLSQSGGQMKKPGESMRLSCRASGYEFLNCPINWIRLAPGRRPEWMGWLKPRGGAVNYARKFQGRVTMTRDVYSDTAFLELRSLTSDDTAVYFCTRGKYCTARDYYNWDFEHWGRGAPVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKX VWKDADTTLFCASDAKAHETECHNVWATHACVPTDPNPQEIHLENVTENFNMWKNNMVEQMQEDVISLWDQCLQPCVKLTGGSVIKQACPKISFDPIPIHYCTPAGYVILKCNDKNFNGTGPCKNVSSVQCTHGIKPVVSTQLLLNGSLAEEEIIIRSENLTNNAKTIIVHLNKSVEINCTRPSNDIRKAYCEINGTKWNKVLKQVTEKLKEHFNNKTIIFQPPSGGDLEITMHHFNCRGEFFYCNTTQLFNNTCIGCNGTITLPCKIKQIINMWQGTGQAMYAPPIDGKINCVSNITGILLTRDGGANNTSNETFRPGGGNIKDNWRSELYKYKVVQIEXXXXXXXCLXX VLTQSPATLSLSPGETAIISCRTSQSGSLAWYQQRPGQAPRLVIYSGSTRAAGIPDRFSGSRWGADYNLSISNLESGDFGVYYCQQYEFFGQGTKVQVDIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECX

2ny7H_3u7yH.pdb
2ny7H.pdb
2ny7HGL-tran.pdb
3u7yHGL-tran.pdb
Jmol tips and trouble shooting