The protein structure alignment is calculated on the following chains: 4jm2:E; 3ngb:G; 4j6r:G.
4jm2:E: GP120; CORE WITH MINI V3 LOOP;
3ngb:G: ENVELOPE GLYCOPROTEIN GP160; UNP RESIDUES 43-122, 201-303, 325-486;
4j6r:G: ENVELOPE GLYCOPROTEIN GP160;
After structure superposition, other chains that are added to the superimposed structures are: 4jm2:A,B; 3ngb:H,L; 4j6r:H,L.
4jm2:A: PGT 135 HEAVY CHAIN; FAB; 4jm2:B: PGT 135 LIGHT CHAIN; FAB;
3ngb:H: ANTIGEN BINDING FRAGMENT OF HEAVY CHAIN: ANTIBODY VRC01; 3ngb:L: ANTIGEN BINDING FRAGMENT OF LIGHT CHAIN: ANTIBODY VRC01;
4j6r:H: HEAVY CHAIN OF ANTIBODY VRC23; 4j6r:L: LIGHT CHAIN OF ANTIBODY VRC23;

# Equivalent-residues=301; RMSD=1.59; P-value=0.00e+00; Identity=71.11%; Similarity=80.32%
/3ngbG.pdb/ /G/ 89 VTENFNMWKNNMVEQMQEDVISLWDQSLQPCVKLTG---------GSVIKQACPKISFDPIPIHYCTPAGYVILKCNDKNFNGTGPCKNVSSVQCTHGIKPVVSTQLLLNGSLAEEEIIIRSENLTNNAKTIIVHLNKSVEINCTRPSN---GDIRKAYCEINGTKWNKVLKQVTEKLKEHFNNKTIIFQPPSGGDLEITMHHFNCRGEFFYCNTTQLFNNTCI--GNETMKGCNGTITLPCKIKQIINMWQGTGQAMYAPPIDGKINCVSNITGILLTRDGGANNTSNETFRPGGGNIKDNWRSELYKYKVVQI

111111111111111111111111111111111111 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 111111111111111111111111111111111111111111111111111111111111111111111111 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111

/4jm2EAB-tran.pdb/ /E/ 89 VTEHFNMWKNNMVEQMQEDIISLWDQSLKPCVKLTPLCVGSGSCDTSVITQACPKISFEPIPIHYCAPAGFAILKCNDKTFNGKGPCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSDNFTNNAKTIIVQLKESVEINCTRPNNNTIGDIRQAHCNISRAKWNDTLKQIVIKLREQFENKTIVFNHSSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWNNNTEGSNNTEGNTITLPCRIKQIINMWQEVGKAMYAPPIRGQIRCSSNITGLLLTRDGGINENGTEIFRPGGGDMRDNWRSELYKYKVVKI


# Equivalent-residues=341; RMSD=1.26; P-value=0.00e+00; Identity=74.21%; Similarity=83.09%
/3ngbG.pdb/ /G/ 44 VWKDADTTLFCASDAKAHETEVHNVWATHACVPTDPNPQEIHLENVTENFNMWKNNMVEQMQEDVISLWDQSLQPCVKLTGGSVIKQACPKISFDPIPIHYCTPAGYVILKCNDKNFNGTGPCKNVSSVQCTHGIKPVVSTQLLLNGSLAEEEIIIRSENLTNNAKTIIVHLNKSVEINCTRPSNGDIRKAYCEINGTKWNKVLKQVTEKLKEHFNNKTIIFQPPSGGDLEITMHHFNCRGEFFYCNTTQLFNNTCI--GNETMKGCNGTITLPCKIKQIINMWQGTGQAMYAPPIDGKINCVSNITGILLTRDGGANNTSNETFRPGGGNIKDNWRSELYKYKVVQIE

11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11111111111111111111111111111111111111111111111111111111111111111111111 111111 1111111111111111111111111111111111111111111111111111111111111111111111111111111111

/4j6rGHL-tran.pdb/ /G/ 44 VWRDADTTLFCASDAKAYETEKHNVWATHACVPTDPNPQEIHLDNVTEKFNMWKNNMVEQMHTDIISLWDQSLKPCVKLTGGSAITQACPKVSFEPIPIHYCTPAGFAILKCKDEGFNGTGLCKNVSTVQCTHGIKPVVSTQLLLNGSLAEKNITIRSENITNNAKIIIVQLVQPVTIKCIR----DIRQAHCNVTRSRWNKTLQEVAEKLRTYFGNKTIIFANSSGGDLEITTHSFNCGGEFFYCNTSGLFNSTWYVNSTWNDT--NDTITLPCRIKQIINMWQRAGQAMYAPPIPGVIKCESNITGLLLTRDGGKDNNVNETFRPGGGDMRDNWRSELYKYKVVEIE


PGT135_VRC01_VRC23-G.pdb
3ngbG.pdb
4jm2EAB-tran.pdb
3ngbGHL-tran.pdb
4j6rGHL-tran.pdb
Jmol tips and trouble shooting